Recombinant Human EEF1A2, N-His
Name : Recombinant Human EEF1A2, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
Q05639
Synonyms :
Recombinant Human EEF1A2, N-His
Amino Acid Sequence :
Molecular Weight :
29.21 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human EEF1A2(Gly213-Lys463) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
531-95-3 site 141-27-5 site PMID:31334949 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant human Ganglioside-induced differentiation-associated protein 2
Product Name :
Recombinant human Ganglioside-induced differentiation-associated protein 2
Brief Description :
Recombinant Protein
Accession No. :
Q9NXN4
Calculated MW :
72 kDa
Target Sequence :
MDPLGAPSQFVDVDTLPSWGDSCQDELNSSDTTAEIFQEDTVRSPFLYNKDVNGKVVLWKGDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLKGCRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLEDATHIALRTVRRFLEIHGETIEKVVFAVSDLEEGTYQKLLPLYFPRSLKEENRSLPYLPADIGNAEGEPVVPERQIRISEKPGAPEDNQEEEDEGLGVDLSFIGSHAFARMEGDIDKQRKLILQGQLSEAALQKQHQRNYNRWLCQARSEDLSDIASLKALYQTGVDNCGRTVMVVVGRNIPVTLIDMDKALLYFIHVMDHIAVKEYVLVYFHTLTSEYNHLDSDFLKKLYDVVDVKYKRNLKAVYFVHPTFRSKVSTWFFTTFSVSGLKDKIHHVDSLHQLFSAISPEQIDFPPFVLEYDARVRSTRSSPSPGMVY
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q9NXN4
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CA IX Antibody Purity & Documentation Insulin Receptor R Antibody Description PMID:35159242 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human DEFA3, N-GST
Name : Recombinant Human DEFA3, N-GST
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
P59666
Synonyms :
Recombinant Human DEFA3, N-GST
Amino Acid Sequence :
Molecular Weight :
34.99 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human DEFA3(Pro21-Cys94) was fused with the N-GST Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
57852-57-0 Description 717824-30-1 supplier PMID:20960239 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Human CD5 Protein, His Tag
Product Name :
Human CD5 Protein, His Tag
Brief Description :
Accession No. :
Calculated MW :
39.5 kDa
Target Sequence :
Storage :
Store at -80˚C for 12 months (Avoid repeated freezing and thawing)
Application Details :
Uniprot :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Colchicine Cancer Opaganib Formula PMID:35226299 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human ATP1A2, N-His
Name : Recombinant Human ATP1A2, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
P50993
Synonyms :
Recombinant Human ATP1A2, N-His
Amino Acid Sequence :
Molecular Weight :
41.25 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human ATP1A2(Lys347-Glu700) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
602306-29-6 manufacturer 112809-51-5 medchemexpress PMID:28613678 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Canis familiaris (Dog) Epididymal secretory protein E1
Product Name :
Recombinant Canis familiaris (Dog) Epididymal secretory protein E1
Brief Description :
Recombinant Protein
Accession No. :
Q28895
Calculated MW :
18 kDa
Target Sequence :
VHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q28895
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
COX2 Antibody Purity MAGEA4 Antibody Protocol PMID:34516363 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human CD362/SDC2, N-His
Name : Recombinant Human CD362/SDC2, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
P34741
Synonyms :
Recombinant Human CD362/SDC2, N-His
Amino Acid Sequence :
Molecular Weight :
16.23 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human CD362 / SDC2(Glu19-Glu144) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
128-53-0 custom synthesis 1009816-48-1 Biological Activity PMID:30480934 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant human ATP-dependent RNA helicase A
Product Name :
Recombinant human ATP-dependent RNA helicase A
Brief Description :
Recombinant Protein
Accession No. :
Q08211
Calculated MW :
74.6 kDa
Target Sequence :
NQVGVVPWSPPQSNWNPWTSSNIDEGPLAFATPEQISMDLKNELMYQLEQDHDLQAILQERELLPVKKFESEILEAISQNSVVIIRGATGCGKTTQVPQFILDDFIQNDRAAECNIVVTQPRRISAVSVAERVAFERGEEPGKSCGYSVRFESILPRPHASIMFCTVGVLLRKLEAGIRGISHVIVDEIHERDINTDFLLVVLRDVVQAYPEVRIVLMSATIDTSMFCEYFFNCPIIEVYGRTYPVQEYFLEDCIQMTHFVPPPKDKKKKDKDDDGGEDDDANCNLICGDEYGPETRLSMSQLNEKETPFELIEALLKYIETLNVPGAVLVFLPGWNLIYTMQKHLEMNPHFGSHRYQILPLHSQIPREEQRKVFDPVPVGVTKVILSTNIAETSITINDVVYVIDSCKQKVKLFTAHNNMTNYATVWASKTNLEQRKGRAGRVRPGFCFHLCSRARFERLETHMTPEMFRTPLHEIALSIKLLRLGGIGQFLAKAIEPPPLDAVIEAEHTLRELD
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q08211
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
NAA10 Antibody In Vivo 4-Bromobutan-1-amine Cancer PMID:34743579 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human ACADL, N-His
Name : Recombinant Human ACADL, N-His
Background :
Background :
Biological Activity :
Species :
Human
Expression System :
Protein Accession :
P28330
Synonyms :
Recombinant Human ACADL, N-His
Amino Acid Sequence :
Molecular Weight :
26.89 kDa
Purity :
>90% as determined by SDS-PAGE.
Storage and Stability :
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 2 to 8 °C for one week .Store at -20 to -80 °C for twelve months from the date of receipt.
Endotoxin Level :
Please contact with the lab for this information.
Construction :
A DNA sequence encoding the Human ACADL(Ile214-Lys430) was fused with the N-His Tag.
Formulation :
0.01M PBS, pH 7.4, 0.02% NLS
Reconstitution :
Reconstitute in sterile water for a stock solution.A copy of datasheet will be provided with the products, please refer to it for details.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
487-52-5 SMILES 483313-22-0 site PMID:29630215 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant mouse Carboxylesterase 1C
Product Name :
Recombinant mouse Carboxylesterase 1C
Brief Description :
Recombinant Protein
Accession No. :
P23953
Calculated MW :
85.6 kDa
Target Sequence :
HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
Storage :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P23953
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
UBP1 Antibody Protocol EHHADH Antibody manufacturer PMID:33821120 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com