Fri. Apr 19th, 2024

Human Chemokine CXCL5

Band: www.medchemexpress.com

C-X-C motif chemokine 5 (CXCL5) or epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a protein that in humans is encoded by the CXCL5 gene. The protein is a small cytokine belonging to the CXC chemokine family. CXCL5 is a ligand for the G protein coupled receptor CXCR2, and is expressed in monocytes, platelets, endothelial cells and mast cells

Teprenone

Molecular Weight 8352.8 Da
Storage Condition Lyophilized powder; Store at -20C
Solubility Freely soluble in water
Purity Greater than 98% by SDS-PAGE, HPLC, MALDI-MS and NMR
Amino Acid Sequence AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Shipping Condition Room temperature

References PubMed ID::http://www.ncbi.nlm.nih.gov/pubmed/18504134

Related Post