Sat. Apr 20th, 2024

Human Chemokine CXCL12

Band: www.medchemexpress.com

C-X-C motif chemokine 12 is small cytokine belonging to the chemokine family that is also known as SDF-1 (stromal cell-derived factor-1). CXCL12 is a ligand for the G protein coupled receptor CXCR4

Alternative Name: SDF-1 alpha

PCI-32767

Molecular Weight 7959.4 Da
Storage Condition Lyophilized powder; Store at -20C
Solubility Freely soluble in water
Purity Greater than 98% by SDS-PAGE, HPLC, MALDI-MS and NMR
Amino Acid Sequence KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Shipping Condition Room temperature

References PubMed ID::http://www.ncbi.nlm.nih.gov/pubmed/18504331

Related Post