Recombinant Human Ribonuclease K6,RNASE6 (C-6His)

By vannoortevents January 29, 2026

Product Name :
Recombinant Human Ribonuclease K6,RNASE6 (C-6His)

Brief Description :

Accession No. :
Q93091

Calculated MW :
15.69kDa

Target Sequence :
WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSILVDHHHHHH

Storage :
Store at Please minimize freeze-thaw cycles.

Application Details :

Uniprot :
Q93091

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
67-68-5 InChIKey 1190389-15-1 InChIKey PMID:20301766 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

By vannoortevents

Uncategorized

Recombinant Human Ribonuclease K6,RNASE6 (C-6His)

By vannoortevents

Related Post

You Missed

Regucalcin

Glutaminyl-peptide cyclotransferase

Rho-related GTP-binding protein RhoC

Plectin