Sat. May 16th, 2026

Name :
PF4 (Human) Recombinant Protein

Biological Activity :
Human PF4 (P02776, 32 a.a. – 101 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.

Tag :

Protein Accession No. :
P02776

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=5196

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Molecular Weight :
10

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
In 20mM Tris-HCl pH 8.0 (0.2 M NaCl, 2 mM DTT and 50% glycerol)

Applications :
SDS-PAGE,

Gene Name :
PF4

Gene Alias :
CXCL4, MGC138298, SCYB4

Gene Description :
platelet factor 4

Gene Summary :
Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair (Eisman et al., 1990 [PubMed 1695112]).[supplied by OMIM

Other Designations :
chemokine (C-X-C motif) ligand 4|platelet factor 4 (chemokine (C-X-C motif) ligand 4)

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B7-H3 medchemexpress
Angiotensin-Converting Enzyme 2 (ACE2) web
Popular categories:
IL-1RA
Cytokines and Growth Factors