Wed. Jan 21st, 2026

Name :
PGF (Human) Recombinant Protein

Biological Activity :
Human PGF (P49763, 21 a.a. – 221 a.a.) partial-length recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :
P49763

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=5228

Amino Acid Sequence :
AVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR.

Molecular Weight :
29

Storage and Stability :
Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
Lyophilized from Acetonitrile and TFA.

Applications :
Functional Study, SDS-PAGE,

Gene Name :
PGF

Gene Alias :
D12S1900, PGFL, PLGF, PLGF-2, SHGC-10760

Gene Description :
placental growth factor

Gene Summary :
vascular endothelial growth factor-related protein|placental growth factor-like

Other Designations :
placenta growth factor|placental growth factor, vascular endothelial growth factor-related protein|placental growth factor-like

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-35 web
IL-5 Proteinsupplier
Popular categories:
Interleukin & Receptors
MIP-1 gamma/CCL9/CCL10