Name :
LGALS4 (Human) Recombinant Protein
Biological Activity :
Human LGALS4 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
P56470
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3960
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Molecular Weight :
38.1
Storage and Stability :
Store at 4°C for 2-4 weeks and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
chromatographic
Quality Control Testing :
Storage Buffer :
Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 1 mM DTT.
Applications :
SDS-PAGE，
Gene Name :
LGALS4
Gene Alias :
GAL4, L36LBP
Gene Description :
lectin, galactoside-binding, soluble, 4
Gene Summary :
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. [provided by RefSeq
Other Designations :
L-36 lactose-binding protein|galectin 4|galectin-4|lactose-binding lectin 4
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IGFBP2 ProteinStorage & Stability
IL-11 MedChemExpress
Popular categories:
Ubiquitin conjugating enzyme E2 S
CD45