Thu. Mar 5th, 2026

Name :
CD226 (Human) Recombinant Protein

Biological Activity :
Human CD226 (Q15762, 19 a.a. – 247 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro

Tag :
Result of bioactivity analysis

Protein Accession No. :
Q15762

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=10666

Amino Acid Sequence :
EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Molecular Weight :
39.3

Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Mammals

Interspecies Antigen Sequence :

Preparation Method :
Mammalian cell (HEK293) expression system

Purification :

Quality Control Testing :

Storage Buffer :
Lyophilized from sterile distilled Water up to 100 ug/mL

Applications :
Functional Study, SDS-PAGE,

Gene Name :
CD226

Gene Alias :
DNAM-1, DNAM1, PTA1, TLiSA1

Gene Description :
CD226 molecule

Gene Summary :
This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. [provided by RefSeq

Other Designations :
CD226 antigen|DNAX accessory molecule-1|T lineage-specific activation antigen 1 antigen|adhesion glycoprotein|platelet and T cell activation antigen 1

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Alkaline Phosphatase Recombinant Proteins
Leukemia Inhibitory Factor Recombinant Proteins
Popular categories:
CD3D-CD3E Heterodimer Proteins
IL-5 Receptor α