Thu. Mar 5th, 2026

Name :
Ifng (Rat) Recombinant Protein

Biological Activity :
Rat Ifng (P01581, 23 a.a.- 156 a.a.) partial recombinant protein expressed in CHO cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :
Result of activity analysis

Protein Accession No. :
P01581

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=25712

Amino Acid Sequence :
QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Molecular Weight :
15 – 25

Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Mammals

Interspecies Antigen Sequence :

Preparation Method :
Mammalian cell (CHO) expression system

Purification :

Quality Control Testing :

Storage Buffer :
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.

Applications :
Functional Study, SDS-PAGE,

Gene Name :
Ifng

Gene Alias :
IFNG2

Gene Description :
interferon gamma

Gene Summary :

Other Designations :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-4 Proteincustom synthesis
Fractalkine/CX3CL1 ProteinSource
Popular categories:
K-Cadherin/Cadherin-6
DPP IV/CD26