Thu. Mar 5th, 2026

Name :
CXCL9 (Human) Recombinant Protein

Biological Activity :
Human CXCL9 (Q07325) recombinant protein expressed in E.Coli.

Tag :

Protein Accession No. :
Q07325

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=4283

Amino Acid Sequence :
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Molecular Weight :
11.7

Storage and Stability :
Stored at -20°C to-80°C for 12 month.After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :

Purification :

Quality Control Testing :
Reducing and Non-Reducing SDS PAGE

Storage Buffer :
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).

Applications :
Western Blot,

Gene Name :
CXCL9

Gene Alias :
CMK, Humig, MIG, SCYB9, crg-10

Gene Description :
chemokine (C-X-C motif) ligand 9

Gene Summary :
The function of this gene has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines. [provided by RefSeq

Other Designations :
monokine induced by gamma interferon|small inducible cytokine B9

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
BTN1A1 Proteincustom synthesis
FGF-1 Proteinsite
Popular categories:
AIM2-like receptors
HPV E6 Proteins