Name :
IL17F (Human) Recombinant Protein
Biological Activity :
Human IL17F (Q96PD4) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of activity analysis
Protein Accession No. :
Q96PD4
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=112744
Amino Acid Sequence :
MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Molecular Weight :
30
Storage and Stability :
Store at -20°C on dry atmosphere.After reconstitution with sterilized water, store at -20°C or lower.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue Non-reducing conditions
Storage Buffer :
Lyophilized from 10 mM sodium citrate, pH 3.0
Applications :
Functional Study， SDS-PAGE，
Gene Name :
IL17F
Gene Alias :
IL-17F, ML-1, ML1
Gene Description :
interleukin 17F
Gene Summary :
The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq
Other Designations :
cytokine ML-1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MCP-1/CCL2 Proteinweb
TIGIT Protein Recombinant Proteins
Popular categories:
ER-beta
SARS-CoV-2 S1 Protein