Name :
ACE (Human) Recombinant Protein (Q01)
Biological Activity :
Human ACE partial ORF ( AAH36375, 592 a.a. – 701 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
AAH36375
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1636
Amino Acid Sequence :
RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYM
Molecular Weight :
37.73
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (77); Rat (72)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
ACE
Gene Alias :
ACE1, CD143, DCP, DCP1, MGC26566
Gene Description :
angiotensin I converting enzyme (peptidyl-dipeptidase A) 1
Gene Summary :
This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Two most abundant alternatively spliced variants of this gene encode two isozymes – the somatic form and the testicular form that are equally active. Multiple additional alternatively spliced variants have been identified but their full length nature has not been determined. [provided by RefSeq
Other Designations :
CD143 antigen|angiotensin I converting enzyme|angiotensin converting enzyme, somatic isoform|carboxycathepsin|dipeptidyl carboxypeptidase 1|kininase II|peptidase P|peptidyl-dipeptidase A|testicular ECA
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-33 Recombinant Proteins
Neurotrophin-4 ProteinGene ID
Popular categories:
HVEM
GPC-3