Mon. Apr 15th, 2024

Lunasin

Band: www.medchemexpress.com

Lunasin is a small peptide that was originally isolated from soybeans (Glycine max), where it is a component of larger 2S albumin seed-storage protein complexes. It has been known for more than a decade that lunasin has cancer preventive properties and has direct anti-mitotic effects by inducing apoptosis of transformed cells

Natural Killer (NK) Cell Activating Peptide

UNC0640

Molecular Weight 4.4 kDa
Storage Condition 4C for up to 3 months without losing activity (do not freeze)
Stock Solution Guide 5 mM in 100 uL of sterilized water
Purity Greater than 98%
Amino Acid Sequence SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD
Shipping Condition Cold pack

References PubMed ID::http://www.ncbi.nlm.nih.gov/pubmed/18504291

Related Post